General Information

  • ID:  hor005724
  • Uniprot ID:  P28674
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Torpedo marmorata (Marbled electric ray)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Torpedo (genus), Torpedinidae (family), Torpediniformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPSKPDNPGEGAPAEDLAKYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MQTNMKFWLGVFTFAFCMLICIGTFADAYPSKPDNPGEGAPAEDLAKYYSALRHYINLITRQRYGKRSSPEALMMTDLMLRENAESFPKYRYDEPFMW
  • Signal peptide:  MQTNMKFWLGVFTFAFCMLICIGTFADA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P28674-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005724_AF2.pdbhor005724_ESM.pdb

Physical Information

Mass: 479310 Formula: C188H284N52O56
Absent amino acids: CFMVW Common amino acids: Y
pI: 8.91 Basic residues: 6
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -103.89 Boman Index: -8675
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 65.28
Instability Index: 5469.72 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  1549597
  • Title:  Strong evolutionary conservation of neuropeptide Y: sequences of chicken, goldfish, and Torpedo marmorata DNA clones.